PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr024234.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 583aa    MW: 64617.4 Da    PI: 6.1019
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr024234.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS424.21.1e-1292125811373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l+elL++cA a+s+++    ++l++  +  +s  g+p+qRl ay++e+L ar   s+ ++y+al+++e +   s + l+++++++e++P+lkf++++a
  Pbr024234.1 212 LKELLIACAGALSNNEVDSFEKLIEIARGAVSIGGEPIQRLGAYLVEGLVARKEASGANIYHALRCREPE---SNDLLSYMQILYEICPYLKFGYMAA 306
                  5799*****************************************************************9...99*********************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  N aI ea  +e+r+HiiDf+i qG+QW++LlqaLa+Rp+g+p++RiTg+++p s+  + + le++g+rL+ + +++++p+ef+  v     d++ ++L
  Pbr024234.1 307 NGAIAEACRNEDRIHIIDFQIAQGTQWVTLLQALAARPSGAPHVRITGIDDPVSKhaRGDGLEAVGRRLKAISDKFNIPVEFHG-VPVFAPDVTRDML 403
                  ***************************************************99988999*************************.688899******* PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  +v+pgEalaVn+ lqlh+++desv+ +++rd +L++v+sl+Pkv ++veqe+++n+++F++rf+e+leyy a+f+s++++lpr+s+eri+vE+++l+r
  Pbr024234.1 404 DVRPGEALAVNFPLQLHHTPDESVDENNPRDGLLRTVRSLNPKVTTLVEQESNTNTTPFFNRFVETLEYYLAMFESIDVTLPRNSKERINVEQHCLAR 501
                  ************************************************************************************************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  +ivnv+aceg+er+erhe ++kW++rl++aGF+++pls+++++ + +llr ++ + y++ e++g+++lgWkdr+L+s+SaW
  Pbr024234.1 502 DIVNVIACEGKERVERHELFGKWKSRLTMAGFQQYPLSSYVNSVIGSLLRCYS-EHYTLVEKDGAMLLGWKDRNLISASAW 581
                  *************************************************9999.66************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.8186563IPR005202Transcription factor GRAS
PfamPF035143.7E-127212581IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MDQHFRFRAT GAGLSHTAPL PTVQSLPKRL LGTLKFDIKN SSNTPFSTDF DSDTLTTLSN  60
SQEQHSSPEN LSGATPSGTS SFETNSYVNR LSLSPSVDCS RDSLQVYSGR ASSLTDANSS  120
QNIKQTLQEL ESALMGPDDE EEVTTANTSS GESSRRQTQR SMSWIQEHQG SNPVQRQTSF  180
VSRQRQLGEA QFEKRHKVID EASLKGLPAS NLKELLIACA GALSNNEVDS FEKLIEIARG  240
AVSIGGEPIQ RLGAYLVEGL VARKEASGAN IYHALRCREP ESNDLLSYMQ ILYEICPYLK  300
FGYMAANGAI AEACRNEDRI HIIDFQIAQG TQWVTLLQAL AARPSGAPHV RITGIDDPVS  360
KHARGDGLEA VGRRLKAISD KFNIPVEFHG VPVFAPDVTR DMLDVRPGEA LAVNFPLQLH  420
HTPDESVDEN NPRDGLLRTV RSLNPKVTTL VEQESNTNTT PFFNRFVETL EYYLAMFESI  480
DVTLPRNSKE RINVEQHCLA RDIVNVIACE GKERVERHEL FGKWKSRLTM AGFQQYPLSS  540
YVNSVIGSLL RCYSEHYTLV EKDGAMLLGW KDRNLISASA WH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-612165828375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009334053.10.0PREDICTED: chitin-inducible gibberellin-responsive protein 1-like
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLM5X9Y90.0M5X9Y9_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s44090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-173GRAS family protein